PDB entry 1sr0

View 1sr0 on RCSB PDB site
Description: Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides
Class: unknown function
Keywords: Signalling protein,involution,crystal structure, UNKNOWN FUNCTION
Deposited on 2004-03-22, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.174
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal processing protein
    Species: Ovis aries [TaxId:9940]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAQ94054 (0-359)
    Domains in SCOPe 2.07: d1sr0a1, d1sr0a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sr0A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v