PDB entry 1sqz

View 1sqz on RCSB PDB site
Description: Design of specific inhibitors of Phopholipase A2: Crystal structure of the complex formed between Group II Phopholipase A2 and a designed peptide Dehydro-Ile-Ala-Arg-Ser at 1.2A resolution
Deposited on 2004-03-22, released 2004-04-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.209
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1sqza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sqzA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c