PDB entry 1sqr

View 1sqr on RCSB PDB site
Description: solution structure of the 50s ribosomal protein l35ae from pyrococcus furiosus. northeast structural genomics consortium target pfr48.
Deposited on 2004-03-19, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sqra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqrA (A:)
    mrikgvvlsyrrskenqhnnvmiikpldvnsreeaskligrlvlwkspsgkilkgkivrv
    hgtkgavrarfekglpgqalgdyveivlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqrA (A:)
    mrikgvvlsyrrskenqhnnvmiikpldvnsreeaskligrlvlwkspsgkilkgkivrv
    hgtkgavrarfekglpgqalgdyveiv