PDB entry 1sqq

View 1sqq on RCSB PDB site
Description: Crystal Structure Analysis of Bovine Bc1 with Methoxy Acrylate Stilbene (MOAS)
Class: oxidoreductase
Keywords: cytochrome bc1, Qo inhibitor, membrane protein, electron transport, OXIDOREDUCTASE
Deposited on 2004-03-19, released 2005-10-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqa1, d1sqqa2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqb1, d1sqqb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqc1, d1sqqc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqd1, d1sqqd2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqe1, d1sqqe2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqf1
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqh_
  • Chain 'I':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqi_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqj_
  • Chain 'K':
    Compound: Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqqk1
  • Heterogens: HEM, UQ2, OST, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqqA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqqB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sqqC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqqD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqqE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sqqF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqF (F:)
    vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sqqG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sqqH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqH (H:)
    eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
    vahklfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sqqI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sqqJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqJ (J:)
    ptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sqqK (K:)
    mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqqK (K:)
    mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkk