PDB entry 1sqp

View 1sqp on RCSB PDB site
Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol
Class: oxidoreductase
Keywords: cytochrome bc1, Qo inhibitor, membrane protein, electron transport, OXIDOREDUCTASE
Deposited on 2004-03-19, released 2005-11-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.264
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpa1, d1sqpa2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpb1, d1sqpb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpc1, d1sqpc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpd1, d1sqpd2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpe1, d1sqpe2
  • Chain 'F':
    Compound: sub6
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1SQP (Start-109)
    Domains in SCOPe 2.05: d1sqpf1
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqph_
  • Chain 'I':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpi_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpj_
  • Chain 'K':
    Compound: Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqpk1
  • Heterogens: PEE, CDL, PLX, HEM, FES, MYX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqpA (A:)
    maasavcraagagtrvllrtrrspallrssdlrgtatyaqalqsvpetqvsqldnglrva
    seqssqptctvgvwidagsryeseknngagyfvehlafkgtknrpgnalekevesmgahl
    naystrehtayyikalskdlpkavelladivqncsledsqiekerdvilqelqendtsmr
    dvvfnylhatafqgtplaqsvegpsenvrklsradlteylsrhykaprmvlaaagglehr
    qlldlaqkhfsglsgtydedavptlspcrftgsqichredglplahvaiavegpgwahpd
    nvalqvanaiighydctygggahlssplasiaatnklcqsfqtfnicyadtgllgahfvc
    dhmsiddmmfvlqgqwmrlctsatesevlrgknllrnalvshldgttpvcedigrsllty
    grriplaewesriaevdarvvrevcskyfydqcpavagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqpB (B:)
    mklltragslsrfyslkvapkvkateapagvpphpqdleftrlpnglviaslenyapasr
    iglfikagsryensnnlgtshllrlasslttkgassfkitrgieavggklsvtstrenma
    ytveclrddvdilmefllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaa
    ayrnalanslycpdyrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflni
    rgglglsgakakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvk
    rgsnatsslyqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvkt
    iaqgnlsnpdvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidava
    dadvinaakkfvsgrksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sqpC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqpD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqpE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sqpF (F:)
    agrpavsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpF (F:)
    vsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sqpG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sqpH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpH (H:)
    elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
    klfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sqpI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sqpJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    n
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sqpK (K:)
    mltrflgpryrqlarnwvptaglwgavgavglvwatdwrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqpK (K:)
    mltrflgpryrqlarnwvptaglwgavgavglvwatdwrlildwvpyingkfk