PDB entry 1sqd

View 1sqd on RCSB PDB site
Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-03-18, released 2004-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, AT1G06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sqda1, d1sqda2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqdA (A:)
    mgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstg
    nmvhasylltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvra
    vaievedaesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekse
    flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
    esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
    emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
    tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyektleak
    qlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqdA (A:)
    knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
    lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
    isvangaipssppivlneavtiaevklygdvvlryvsykaeflpgfervedassfpldyg
    irrldhavgnvpelgpaltyvagftgfhqfaeftsglnsavlasndemvllpinepvhgk
    sqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvg
    dvlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcgg
    fgkgnfselfksi