PDB entry 1sqb

View 1sqb on RCSB PDB site
Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
Deposited on 2004-03-18, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqbA (A:)
    maasavcraagagtrvllrtrrspallrssdlrgtatyaqalqsvpetqvsqldnglrva
    seqssqptctvgvwidagsryeseknngagyfvehlafkgtknrpgnalekevesmgahl
    naystrehtayyikalskdlpkavelladivqncsledsqiekerdvilqelqendtsmr
    dvvfnylhatafqgtplaqsvegpsenvrklsradlteylsrhykaprmvlaaagglehr
    qlldlaqkhfsglsgtydedavptlspcrftgsqichredglplahvaiavegpgwahpd
    nvalqvanaiighydctygggahlssplasiaatnklcqsfqtfnicyadtgllgahfvc
    dhmsiddmmfvlqgqwmrlctsatesevlrgknllrnalvshldgttpvcedigrsllty
    grriplaewesriaevdarvvrevcskyfydqcpavagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqbB (B:)
    mklltragslsrfyslkvapkvkateapagvpphpqdleftrlpnglviaslenyapasr
    iglfikagsryensnnlgtshllrlasslttkgassfkitrgieavggklsvtstrenma
    ytveclrddvdilmefllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaa
    ayrnalanslycpdyrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflni
    rgglglsgakakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvk
    rgsnatsslyqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvkt
    iaqgnlsnpdvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidava
    dadvinaakkfvsgrksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbB (B:)
    agvpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlass
    lttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrr
    wevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdy
    vqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvh
    aalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafna
    sysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsves
    segfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtp
    fidel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sqbC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqbD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqbE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sqbF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbF (F:)
    vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sqbG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sqbH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbH (H:)
    elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
    klfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sqbI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sqbJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    n
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sqbK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvwatdsrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqbK (K:)
    ltrflgpryrqlarnwvptaqlwgavgavglvwatdsrlildwvpyingkfk