PDB entry 1sq0

View 1sq0 on RCSB PDB site
Description: Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution
Class: blood clotting
Keywords: Leucine Rich Repeat (LRR), right-handed beta-alpha superhelix); Integrin A (or I) domain fold, BLOOD CLOTTING
Deposited on 2004-03-17, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II]
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF, F8VWF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq0a_
  • Chain 'B':
    Compound: Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (CD42B-alpha) (CD42B) [Contains: Glycocalicin]
    Species: Homo sapiens [TaxId:9606]
    Gene: GP1BA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359 (0-End)
      • see remark 999 (20)
      • see remark 999 (158)
    Domains in SCOPe 2.07: d1sq0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq0A (A:)
    medisepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvav
    veyhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeas
    rialllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkaf
    vlssvdeleqqrdeivsylcdlapeappptlpph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq0A (A:)
    dfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshay
    iglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasq
    epqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleq
    qrdeivsylcdlapeapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sq0B (B:)
    hpicevskvashlevncdkrdltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslanndltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq0B (B:)
    hpicevskvashlevncdkrdltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslanndltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
    snvasvqcdnsdkfpvykypgkgcp