PDB entry 1sps

View 1sps on RCSB PDB site
Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms
Deposited on 1993-03-05, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.18
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1spsa_
  • Chain 'B':
    Domains in SCOP 1.55: d1spsb_
  • Chain 'C':
    Domains in SCOP 1.55: d1spsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1spsA (A:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1spsB (B:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1spsC (C:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt