PDB entry 1spp

View 1spp on RCSB PDB site
Description: the crystal structures of two members of the spermadhesin family reveal the folding of the cub domain
Deposited on 1997-06-19, released 1998-06-24
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-24, with a file datestamp of 1998-06-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1sppa_
  • Chain 'B':
    Domains in SCOP 1.55: d1sppb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sppA (A:)
    ldyhacggrltddygtiftykgpktecvwtlqvdpkykllvsiptlnltcgkeyvevleg
    apgskslgkfceglsilnrgssgmtvkykrdsghpaspyeiiflrdsqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sppB (B:)
    aringpdecgrvikdtsgsisntdrqknlctwtilmkpdqkvrmaipylnlacgkeyvev
    fdgllsgpsygklcagaaivflstantmtikynrisgnssspfliyfygssp