PDB entry 1sph

View 1sph on RCSB PDB site
Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-11-03, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.143
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (1-87)
      • conflict (45)
    Domains in SCOPe 2.07: d1spha_
  • Chain 'B':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (1-87)
      • conflict (45)
    Domains in SCOPe 2.07: d1sphb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sphA (A:)
    maqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgae
    itisasgadendalnaleetmkseglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sphA (A:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
    tisasgadendalnaleetmkseglge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sphB (B:)
    maqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgae
    itisasgadendalnaleetmkseglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sphB (B:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
    tisasgadendalnaleetmkseglge