PDB entry 1sp9

View 1sp9 on RCSB PDB site
Description: 4-Hydroxyphenylpyruvate Dioxygenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-03-16, released 2004-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, AT1G06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sp9a1, d1sp9a2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, AT1G06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sp9b1, d1sp9b2
  • Heterogens: FE2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sp9A (A:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp9A (A:)
    vrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyllts
    gdlrflftapyspstasipsfdhgscrsffsshglgvravaievedaesafsisvangai
    pssppivlneavtiaevklygdvvlryvsykflpgfervepldygirrldhavgnvpelg
    paltyvagftgfhqfasglnsavlasndemvllpinepvhgtkrksqiqtylehnegagl
    qhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelg
    ilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfse
    lf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sp9B (B:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp9B (B:)
    vrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyllts
    gdlrflftapyspstasipsfdhgscrsffsshglgvravaievedaesafsisvangai
    pssppivlneavtiaevklygdvvlryvsykflpgfervepldygirrldhavgnvpelg
    paltyvagftgfhqfaeftsglnsavlasndemvllpinepvhgtkrksqiqtylehneg
    aglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikece
    elgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgn
    fselfksieeyekt