PDB entry 1sow

View 1sow on RCSB PDB site
Description: T. gondii bradyzoite-specific LDH (LDH2) in complex with NAD and oxalate
Class: oxidoreductase
Keywords: Rossmann fold, tetramer, NAD-binding, oxidoreductase
Deposited on 2004-03-15, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sowa1, d1sowa2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sowb1, d1sowb2
  • Heterogens: OXL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sowA (A:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalgpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sowA (A:)
    tvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtnv
    svtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycpl
    afvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatvi
    gthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsayy
    apalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielelthe
    eqecfrksvddvvelnkslaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sowB (B:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalgpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sowB (B:)
    gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
    vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
    lafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatv
    igthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsay
    yapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielelth
    eeqecfrksvddvvelnkslaal