PDB entry 1sov

View 1sov on RCSB PDB site
Description: Toxoplasma gondii bradyzoite-specific LDH (LDH2) apo form
Class: oxidoreductase
Keywords: Rossmann fold, tetramer, NAD-binding, OXIDOREDUCTASE
Deposited on 2004-03-15, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sova1, d1sova2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sovb1, d1sovb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sovA (A:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalgpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sovA (A:)
    gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
    vsvtsanqyekiagsdvviitagltkvpsrndllpfnakiirevaqgvkkycplafvivv
    tnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatvigthgdh
    mlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsayyapalsa
    itmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvieleltheeqecfr
    ksvddvvelnkslaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sovB (B:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalgpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sovB (B:)
    gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
    vsvtsanqyekiagsdvviitagltkvsrndllpfnakiirevaqgvkkycplafvivvt
    npldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatvigthgdhm
    lplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsayyapalsai
    tmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvieleltheeqecfrk
    svddvvelnkslaal