PDB entry 1sos

View 1sos on RCSB PDB site
Description: atomic structures of wild-type and thermostable mutant recombinant human cu, zn superoxide dismutase
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase (superoxide acceptor)
Deposited on 1992-02-11, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosa_
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosb_
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosc_
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosd_
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sose_
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosf_
  • Chain 'G':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosg_
  • Chain 'H':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosh_
  • Chain 'I':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosi_
  • Chain 'J':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sosj_
  • Heterogens: CU, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosB (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosC (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosD (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosE (E:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosF (F:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosG (G:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosH (H:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosI (I:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sosJ (J:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq