PDB entry 1so2

View 1so2 on RCSB PDB site
Description: CATALYTIC DOMAIN OF HUMAN PHOSPHODIESTERASE 3B In COMPLEX WITH A DIHYDROPYRIDAZINE INHIBITOR
Class: hydrolase
Keywords: pde3b phosphodiesterase, hydrolase
Deposited on 2004-03-12, released 2004-05-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so2a_
  • Chain 'B':
    Compound: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so2b_
  • Chain 'C':
    Compound: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so2c_
  • Chain 'D':
    Compound: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so2d_
  • Heterogens: MG, HG9, 666, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so2A (A:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2A (A:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
    npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
    haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
    sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
    spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
    iwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1so2B (B:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2B (B:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
    npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
    haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
    sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
    spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
    iwk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1so2C (C:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2C (C:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcdsdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcql
    mhhltenhkiwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1so2D (D:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2D (D:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngnhgriayissks
    csnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvle
    nhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakand
    vnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlgl
    pispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaerrifcqlmhhlten
    hkiwk