PDB entry 1so0

View 1so0 on RCSB PDB site
Description: Crystal structure of human galactose mutarotase complexed with galactose
Class: isomerase
Keywords: mutartoase, epimerase, galactosemia, isomerase
Deposited on 2004-03-12, released 2004-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose 1-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C23 (2-343)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1so0a_
  • Chain 'B':
    Compound: aldose 1-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so0b_
  • Chain 'C':
    Compound: aldose 1-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C23 (2-343)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1so0c_
  • Chain 'D':
    Compound: aldose 1-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1so0d_
  • Heterogens: GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1so0A (A:)
    ghmasvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlg
    faelegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlw
    tprvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsy
    fnlagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfh
    lngfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavy
    pkhsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1so0B (B:)
    ghmasvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlg
    faelegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlw
    tprvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsy
    fnlagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfh
    lngfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavy
    pkhsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so0B (B:)
    masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
    elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
    rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
    lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
    gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
    hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1so0C (C:)
    ghmasvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlg
    faelegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlw
    tprvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsy
    fnlagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfh
    lngfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavy
    pkhsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1so0D (D:)
    ghmasvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlg
    faelegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlw
    tprvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsy
    fnlagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfh
    lngfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavy
    pkhsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so0D (D:)
    masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
    elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
    rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
    lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
    gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
    hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva