PDB entry 1snx

View 1snx on RCSB PDB site
Description: crystal structure of apo interleukin-2 tyrosine kinase catalytic domain
Class: transferase
Keywords: protein kinase, immunology, transferase
Deposited on 2004-03-12, released 2004-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.252
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1snxa_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1snxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snxA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snxA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1snxB (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snxB (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg