PDB entry 1snx

View 1snx on RCSB PDB site
Description: crystal structure of apo interleukin-2 tyrosine kinase catalytic domain
Deposited on 2004-03-12, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.241
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1snxa_
  • Chain 'B':
    Domains in SCOP 1.69: d1snxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snxA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snxA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1snxB (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snxB (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg