PDB entry 1snt

View 1snt on RCSB PDB site
Description: Structure of the human cytosolic sialidase Neu2
Class: hydrolase
Keywords: sialidase, neuraminidase, ganglioside, hydrolase
Deposited on 2004-03-12, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1snta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sntA (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sntA (A:)
    slpvlqkesvfqsgahayripallylpgqqsllafaeqraelivlrrgdydapthqvqwq
    aqevvaqarldghrsmnpcplydaqtgtlflffiaipanvtrlcqvtstdhgrtwssprd
    ltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafcflshd
    hgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlrarvqaqstndgldfqesqlv
    kklvepppqgcqgsvisfpsprspaqwllythpthswqradlgaylnprppapeawsepv
    llakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey