PDB entry 1snm

View 1snm on RCSB PDB site
Description: active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes
Deposited on 1990-02-15, released 1991-07-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.74 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1snm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1snm_ (-)
  lhkepatlikaidgdtvklmykgqpmtfrlllvdtpdtkhpkkgvekygpeasaftkkmv
  enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
  kseaqakkeklniwse