PDB entry 1sms

View 1sms on RCSB PDB site
Description: Structure of the Ribonucleotide Reductase Rnr4 Homodimer from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-03-09, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.266
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase small chain 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR4, YGR180C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smsa_
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase small chain 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR4, YGR180C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smsb_
  • Heterogens: HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smsA (A:)
    meahnqflktfqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtae
    eielakdtedfqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfq
    immeniysevysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlv
    afaakegifqagnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnp
    kiiekiiteaveiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyynavnp
    fefmedvatagkttffekkvsdyqkasdmsksatpskeinfdddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smsA (A:)
    ahnqflktfqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeei
    elakdtedfqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfqim
    meniysevysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlvaf
    aakegifqagnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpki
    iekiiteaveiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyynavnpfe
    fmeffekkvsdyqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smsB (B:)
    meahnqflktfqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtae
    eielakdtedfqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfq
    immeniysevysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlv
    afaakegifqagnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnp
    kiiekiiteaveiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyynavnp
    fefmedvatagkttffekkvsdyqkasdmsksatpskeinfdddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smsB (B:)
    ahnqflktfqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeei
    elakdtedfqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfqim
    meniysevysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlvaf
    aakegifqagnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpki
    iekiiteaveiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyynavnpfe
    fmeffekkvsdyqk