PDB entry 1smq

View 1smq on RCSB PDB site
Description: Structure of the Ribonucleotide Reductase Rnr2 Homodimer from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-03-09, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.272
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase small chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR2, YJL026W, J1271
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smqa_
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase small chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR2, YJL026W, J1271
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smqb_
  • Chain 'C':
    Compound: ribonucleoside-diphosphate reductase small chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR2, YJL026W, J1271
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smqc_
  • Chain 'D':
    Compound: ribonucleoside-diphosphate reductase small chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RNR2, YJL026W, J1271
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1smqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1smqA (A:)
    mpketpskaaadalsdleikdsksnlnkeletlreenrvksdmlkeklskdaenhkaylk
    shqvhrhklkemekeepllnedkertvlfpikyheiwqaykraeasfwtaeeidlskdih
    dwnnrmnenerffisrvlaffaasdgivnenlvenfstevqipeaksfygfqimienihs
    etysllidtyikdpkeseflfnaihtipeigekaewalrwiqdadalfgerlvafasieg
    vffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfacllfahlknkpdpaivekiv
    teaveieqryfldalpvallgmnadlmnqyvefvadrllvafgnkkyykvenpfdfmeni
    slagktnffekrvsdyqkagvmskstkqeagaftfnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smqA (A:)
    lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
    tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaase
    nlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipei
    gekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelic
    rdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqy
    vefvadrllvafgnkkyykvenpfdfmen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1smqB (B:)
    mpketpskaaadalsdleikdsksnlnkeletlreenrvksdmlkeklskdaenhkaylk
    shqvhrhklkemekeepllnedkertvlfpikyheiwqaykraeasfwtaeeidlskdih
    dwnnrmnenerffisrvlaffaasdgivnenlvenfstevqipeaksfygfqimienihs
    etysllidtyikdpkeseflfnaihtipeigekaewalrwiqdadalfgerlvafasieg
    vffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfacllfahlknkpdpaivekiv
    teaveieqryfldalpvallgmnadlmnqyvefvadrllvafgnkkyykvenpfdfmeni
    slagktnffekrvsdyqkagvmskstkqeagaftfnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smqB (B:)
    lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
    tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaase
    nlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipei
    gekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelic
    rdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqy
    vefvadrllvafgnkkyykvenpfdfmen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1smqC (C:)
    mpketpskaaadalsdleikdsksnlnkeletlreenrvksdmlkeklskdaenhkaylk
    shqvhrhklkemekeepllnedkertvlfpikyheiwqaykraeasfwtaeeidlskdih
    dwnnrmnenerffisrvlaffaasdgivnenlvenfstevqipeaksfygfqimienihs
    etysllidtyikdpkeseflfnaihtipeigekaewalrwiqdadalfgerlvafasieg
    vffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfacllfahlknkpdpaivekiv
    teaveieqryfldalpvallgmnadlmnqyvefvadrllvafgnkkyykvenpfdfmeni
    slagktnffekrvsdyqkagvmskstkqeagaftfnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smqC (C:)
    lnkeletlreenrvksdmlkeklskdaenhkalkemekeepllnedkertvlfpikyhei
    wqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasenlvenfstevq
    ipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipeigekaewalrwi
    qdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfac
    llfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqyvefvadrllva
    fgnkkyykvenpfdfmen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1smqD (D:)
    mpketpskaaadalsdleikdsksnlnkeletlreenrvksdmlkeklskdaenhkaylk
    shqvhrhklkemekeepllnedkertvlfpikyheiwqaykraeasfwtaeeidlskdih
    dwnnrmnenerffisrvlaffaasdgivnenlvenfstevqipeaksfygfqimienihs
    etysllidtyikdpkeseflfnaihtipeigekaewalrwiqdadalfgerlvafasieg
    vffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfacllfahlknkpdpaivekiv
    teaveieqryfldalpvallgmnadlmnqyvefvadrllvafgnkkyykvenpfdfmeni
    slagktnffekrvsdyqkagvmskstkqeagaftfnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1smqD (D:)
    lnkeletlreenrvksdmlkeklskdaenhkalkemekeepllnedkertvlfpikyhei
    wqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasenlvenfstevq
    ipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipeigekaewalrwi
    qdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelicrdeglhtdfac
    llfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqyvefvadrllva
    fgnkkyykvenpfdfmen