PDB entry 1smp

View 1smp on RCSB PDB site
Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi
Deposited on 1995-01-13, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smpA (A:)
    tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
    dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
    rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
    lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
    hlyganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqri
    nlneksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfgggg
    adelwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffnkeanssdfihfvdhf
    sgtageallsynassnvtdlsvnigghqapdflvkivgqvdvatdfiv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1smpI (I:)
    sslrlpsaaelsgqwvlsgaeqhcdirlntdvldgttwklagdtaclqkllpeapvgwrp
    tpdgltltqadgsavaffsrnrdryehklvdgsvrtlkkk