PDB entry 1smh

View 1smh on RCSB PDB site
Description: Protein kinase A variant complex with completely ordered N-terminal helix
Class: signaling protein,transferase/inhibitor
Keywords: PKA; Protein Kinase A; cAMP-dependent protein kinase; phosphorylation; Ser10; myristoylation; posttranslational modification; signaling; membrane, alpha helix, SIGNALING PROTEIN,TRANSFERASE/INHIBITOR COMPLEX
Deposited on 2004-03-09, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
  Species: Bos taurus [TaxId:9913]
  Gene: PRKACA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00517 (0-349)
    • engineered (83)
    • engineered (122)
    • engineered (172)
    • engineered (186)
    • modified residue (196)
    • modified residue (337)
  Domains in SCOPe 2.08: d1smha_
• Chain 'B':
  Compound: cAMP-dependent protein kinase inhibitor, alpha form
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04541 (0-19)
• Heterogens: BU3, MG8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1smhA (A:)
  gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
  khmetgnhyamkildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvm
  eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi
  qvtdfglakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
  dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
  dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
  

  
  
• Chain 'B':
  No sequence available.