PDB entry 1sm3

View 1sm3 on RCSB PDB site
Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
Deposited on 1997-12-23, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sm3H (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvssakt
    tpptvyplapgsnaasqsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdakivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm3H (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvssakt
    tpptvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlytlsssvt
    vpsstwpsetvtcnvahpasstkvdakivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sm3L (L:)
    ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgseksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarawerhssyscqvtheghtvekslsr