PDB entry 1sm2

View 1sm2 on RCSB PDB site
Description: Crystal structure of the phosphorylated Interleukin-2 tyrosine kinase catalytic domain
Class: transferase
Keywords: Protein Kinase, Immunology, TRANSFERASE
Deposited on 2004-03-08, released 2004-07-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1sm2a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1sm2b_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sm2A (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm2A (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sm2B (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sm2B (B:)
    idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
    lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
    vihrdlaarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegk
    ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia
    e