PDB entry 1sky

View 1sky on RCSB PDB site
Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3
Deposited on 1997-02-26, released 1998-03-04
The last revision prior to the SCOP 1.63 freeze date was dated 1998-03-04, with a file datestamp of 1998-03-04.
Experiment type: XRAY
Resolution: N/A
R-factor: 0.222
AEROSPACI score: -0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1skyB (B:)
    sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt
    gikegdevrrtgrimevpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrr
    svheplqtgikaidalvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigq
    kestvatvvetlakhgapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvvi
    ddlskqaaayrqlslllrrppgreaypgdifylhsrlleraaklsdakgggsltalpfve
    tqagdisayiptnvisitdgqiflqsdlffsgvrpainaglsvsrvggaaqikamkkvag
    tlrldlaayreleafaqfgsdldkatqanvargartvevlkqdlhqpipvekqvliiyal
    trgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieafkktfvv
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1skyB (B:)
    sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt
    gikegdevrrtgrimevpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrr
    svheplqtgikaidalvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigq
    kestvatvvetlakhgapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvvi
    ddlskqaaayrqlslllrrppgreaypgdifylhsrlleraaklsdakgggsltalpfve
    tqagdisayiptnvisitdgqiflqsdlffsgvrpainaglsvsrvggaaqikamkkvag
    tlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqvliiyaltrg
    flddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieafkktfvvsq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1skyE (E:)
    mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
    tiamastdglirgmevidtgapisvpvgqvtlgrvfnvlgepidlegdipadarrdpihr
    papkfeelateveiletgikvvdllapyikggkiglfggagvgktvliqelihniaqehg
    gisvfagvgertregndlyhemkdsgvisktamvfgqmneppgarmrvaltgltmaeyfr
    deqgqdgllfidnifrftqagsevsallgrmpsaigyqptlatemgqlqeritstakgsi
    tsiqaiyvpaddytdpapattfshldattnlerklaemgiypavdplvstsralapeivg
    eehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhvaeqf
    tgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamg