PDB entry 1sk1

View 1sk1 on RCSB PDB site
Description: arsenate reductase r60k mutant +0.4m arsenate from e. coli
Class: oxidoreductase
Keywords: arsc, reductase, arsenite, arsenate, oxidoreductase
Deposited on 2004-03-04, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08692 (Start-139)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d1sk1a_
  • Heterogens: SO4, CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sk1A (A:)
    msnitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallk
    knvepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaq
    kgaftkedgekvvdeagkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sk1A (A:)
    nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallkkn
    vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
    aftkedgekvvdeagkrl