PDB entry 1sjx

View 1sjx on RCSB PDB site
Description: Three-Dimensional Structure of a Llama VHH Domain OE7 binding the cell wall protein Malf1
Class: immune system
Keywords: Camelids antibody, heavy chain, dandruff, phage display, IMMUNE SYSTEM
Deposited on 2004-03-04, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin VH domain
    Species: LAMA GLAMA, synthetic [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1SJX (0-End)
    Domains in SCOPe 2.07: d1sjxa1, d1sjxa2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjxA (A:)
    qvqlqesggglvqaggslrlscqasgnifrindmgwyrqapgtqrelvaaitsggstkya
    dsvkgrftiskdnakntvylqmnslkpedtavyycaaedrhrigtvgywgqgtqvtvssv
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjxA (A:)
    qvqlqesggglvqaggslrlscqasgnifrindmgwyrqapgtqrelvaaitsggstkya
    dsvkgrftiskdnakntvylqmnslkpedtavyycaaedrhrigtvgywgqgtqvtvss