PDB entry 1sjp

View 1sjp on RCSB PDB site
Description: Mycobacterium tuberculosis Chaperonin60.2
Class: chaperone
Keywords: CHAPERONE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2004-03-04, released 2004-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kDa chaperonin 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1sjpa1, d1sjpa2, d1sjpa3
  • Chain 'B':
    Compound: 60 kDa chaperonin 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1sjpb1, d1sjpb2, d1sjpb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sjpA (A:)
    wgaptitndgvsiakeieledpyekigaelvkevakktddvagdgtttatvlaqalvreg
    lrnvaaganplglkrgiekavekvtetllkgakevetkeqiaataaisagdqsigdliae
    amdkvgnegvitveesntfglqleltegmrfdkgyisgyfvtdperqeavledpyillvs
    skvstvkdllpllekvigagkplliiaedvegealstlvvnkirgtfksvavkapgfgdr
    rkamlqdmailtggqviseevgltlenadlsllgkarkvvvtkdettivegagdtdaiag
    rvaqirqeiensdsdydreklqerlaklaggvavikagaatevelkerkhriedavrnak
    aaveegivagggvtllqaaptldelklegdeatganivkvaleaplkqiafnsglepgvv
    aekvrnlpaghglnaqtgvyedllaagvadpvkvtrsalqnaasiaglfltteavvadkp
    ekekasvpgggdmggmdfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjpA (A:)
    ledpyekigaelvkevakktttatvlaqalvreglrnvaaganplglkrgiekavekvte
    tllkgakevetkeqiaataaisagdqsigdliaeamdkvgnegvitveesntfglqlelt
    egmrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkpllii
    aedvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltle
    nadlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerla
    klaggvavikagaatevelkerkhriedavrnakaaveegivagggvtllqaaptldelk
    legdeatganivkvaleaplkqiafnsglepgvvaekvrnlpaghglnaqtgvyedllaa
    gvadpvkvtrsalqnaasiaglfltte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sjpB (B:)
    wgaptitndgvsiakeieledpyekigaelvkevakktddvagdgtttatvlaqalvreg
    lrnvaaganplglkrgiekavekvtetllkgakevetkeqiaataaisagdqsigdliae
    amdkvgnegvitveesntfglqleltegmrfdkgyisgyfvtdperqeavledpyillvs
    skvstvkdllpllekvigagkplliiaedvegealstlvvnkirgtfksvavkapgfgdr
    rkamlqdmailtggqviseevgltlenadlsllgkarkvvvtkdettivegagdtdaiag
    rvaqirqeiensdsdydreklqerlaklaggvavikagaatevelkerkhriedavrnak
    aaveegivagggvtllqaaptldelklegdeatganivkvaleaplkqiafnsglepgvv
    aekvrnlpaghglnaqtgvyedllaagvadpvkvtrsalqnaasiaglfltteavvadkp
    ekekasvpgggdmggmdfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjpB (B:)
    dpyekigaelvkevakktttatvlaqalvreglrnvaaganplglkrgiekavekvtetl
    lkgakevetkeqiaataaisagdqsigdliaeamdkvgnegvitveesntfglqlelteg
    mrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkplliiae
    dvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltlena
    dlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerlakl
    aggvavikagaatevelkerkhriedavrnakaaveegivagggvtllqaaptldelkle
    gdeatganivkvaleaplkqiafnsglepgvvaekvrnlpaghglnaqtgvyedllaagv
    adpvkvtrsalqnaasiaglfltte