PDB entry 1sje

View 1sje on RCSB PDB site
Description: HLA-DR1 complexed with a 16 residue HIV capsid peptide bound in a hairpin conformation
Class: immune system
Keywords: MHC class II, Major histocompatibility protein complex, HLA-DR1, HIV-1, capsid, Superantigen, Antigen, Peptide, gag, IMMUNE SYSTEM
Deposited on 2004-03-03, released 2004-08-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.196
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA*0101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1sjea1, d1sjea2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB*0101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1sjeb1, d1sjeb2
  • Chain 'C':
    Compound: gag polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SEC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-238)
      • engineered (42)
      • engineered (44-46)
    Domains in SCOPe 2.02: d1sjed1, d1sjed2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjeA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sjeB (B:)
    gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvs
    gfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sjeD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sjeD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegnhfdngn
    lqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyik
    fienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng