PDB entry 1sj4

View 1sj4 on RCSB PDB site
Description: Crystal structure of a C75U mutant Hepatitis Delta Virus ribozyme precursor, in Cu2+ solution
Class: translation/RNA
Keywords: HDV; ribozyme; RNA; U1A; precurosr, TRANSLATION-RNA COMPLEX
Deposited on 2004-03-02, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.06: d1sj4p_
  • Chain 'R':
    Compound: precursor form of the Hepatitis Delta virus ribozyme
    Species: Hepatitis delta virus [TaxId:12475]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1sj4P (P:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sj4P (P:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'R':
    No sequence available.