PDB entry 1sj3

View 1sj3 on RCSB PDB site
Description: Hepatitis Delta Virus Gemonic Ribozyme Precursor, with Mg2+ Bound
Class: translation/RNA
Keywords: HDV; ribozyme; RNA; U1A; precurosr, TRANSLATION-RNA COMPLEX
Deposited on 2004-03-02, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.255
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.08: d1sj3p_
  • Chain 'R':
    Compound: precursor form of the Hepatitis Delta virus ribozyme
    Species: Hepatitis delta virus [TaxId:12475]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >1sj3P (P:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt

    Sequence, based on observed residues (ATOM records): (download) 
    >1sj3P (P:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

  • Chain 'R':
    No sequence available.