PDB entry 1siw

View 1siw on RCSB PDB site
Description: Crystal structure of the apomolybdo-NarGHI
Class: oxidoreductase
Keywords: apomolybdo-NarGHI; electron-transfer; membrane protein, OXIDOREDUCTASE
Deposited on 2004-03-01, released 2004-06-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Respiratory nitrate reductase 1 alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: Operon narGHJI: NARG, NARC, BISD, B1224
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1siwa1, d1siwa2
  • Chain 'B':
    Compound: Respiratory nitrate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: Operon narGHJI: NARH, B1225
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1siwb_
  • Chain 'C':
    Compound: Respiratory nitrate reductase 1 gamma chain
    Species: Escherichia coli [TaxId:562]
    Gene: Operon narGHJI: NARI, CHLI, B1227
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11350 (0-224)
      • formylation (0)
    Domains in SCOPe 2.03: d1siwc_
  • Heterogens: GDP, HEM, SF4, F3S, 3PH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1siwA (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1siwA (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvgscswkiyv
    knglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkmwre
    akalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytiknygpd
    rvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpesadw
    ynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqgtda
    amalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadlvda
    lgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsllgsq
    deiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlanygl
    erglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiivgag
    lnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqrpar
    hmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapqlgt
    npltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgssgkg
    hefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstclysd
    iilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvghlgk
    etdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerftsig
    plmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlapetn
    gqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehvsyn
    agytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksngnqe
    kalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfnsnga
    ltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmiggyah
    laygfnyygtvgsnrdefvvvrkmknidwldgegndqvqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1siwB (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtsktephp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1siwB (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtskt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1siwC (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
    tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
    afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1siwC (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgad
    ililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrl
    hlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh