PDB entry 1sip

View 1sip on RCSB PDB site
Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1994-04-13, released 1994-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unliganded siv protease
  Species: Chimpanzee immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q87706 (0-97)
    • conflict (71)
  Domains in SCOP 1.75: d1sipa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sipA (A:)
  pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
  nveievlgkrirgtimtgdtpinifgrnlltalgmslnf