PDB entry 1sie

View 1sie on RCSB PDB site
Description: murine polyomavirus complexed with a disialylated oligosaccharide
Class: Virus
Keywords: COAT PROTEIN, Icosahedral virus, Virus
Deposited on 1995-12-12, released 1996-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.244
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1siea_
  • Chain 'B':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sieb_
  • Chain 'C':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1siec_
  • Chain 'D':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sied_
  • Chain 'E':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1siee_
  • Chain 'F':
    Compound: polyomavirus coat protein vp1
    Species: Mouse polyomavirus (strain p16 small-plaque) [TaxId:47935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sief_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sieA (A:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieA (A:)
    kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
    rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
    dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
    tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
    ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
    ktvfpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sieB (B:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieB (B:)
    kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
    rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
    dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
    tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
    ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
    ktvfpgn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sieC (C:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieC (C:)
    kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
    rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
    dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
    tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
    ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sieD (D:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieD (D:)
    kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
    rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
    dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
    tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
    ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    npypmaslisslfnnmlpqvqgqpmegentqveevrvydg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sieE (E:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieE (E:)
    kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
    rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
    dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
    tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
    ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
    ktvfpgn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sieF (F:)
    apkrkagvskcetkctkacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqp
    ptpeslteggqyygwsrginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmw
    eavsvktevvgsgslldvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtd
    artkykeegvvtiktitkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryf
    gnytggtttppvlqftntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwr
    glpryfkitlrkrwvknpypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepv
    pgdpdmtryvdrfgktktvfpgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sieF (F:)
    acprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsr
    ginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslld
    vhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktit
    kkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftn
    tlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvkn
    pypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvd