PDB entry 1shg

View 1shg on RCSB PDB site
Description: crystal structure of a src-homology 3 (sh3) domain
Deposited on 1993-05-19, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1shg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1shg_ (-)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld