PDB entry 1sh9

View 1sh9 on RCSB PDB site
Description: Comparing the Accumulation of Active Site and Non-active Site Mutations in the HIV-1 Protease
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, non-active site mutations, active site mutations, ritonavir, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2004-02-25, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (19)
      • engineered (31-32)
      • engineered (35)
      • engineered (53)
      • engineered (62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1sh9a_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (19)
      • engineered (31-32)
      • engineered (35)
      • engineered (53)
      • engineered (62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1sh9b_
  • Heterogens: RIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sh9A (A:)
    pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpanvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sh9B (B:)
    pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpanvigrnlmtqigctlnf