PDB entry 1sgu

View 1sgu on RCSB PDB site
Description: Comparing the Accumulation of Active Site and Non-active Site Mutations in the HIV-1 Protease
Class: hydrolase
Keywords: active site mutations, non-active site mutations, indinavir, hiv-1 protease, hydrolase
Deposited on 2004-02-24, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (19)
      • engineered (31-32)
      • engineered (35)
      • engineered (53)
      • engineered (62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1sgua_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (19)
      • engineered (31-32)
      • engineered (35)
      • engineered (53)
      • engineered (62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1sgub_
  • Heterogens: MK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sguA (A:)
    pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpanvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sguB (B:)
    pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
    qipieicghkvigtvlvgptpanvigrnlmtqigctlnf