PDB entry 1sgj

View 1sgj on RCSB PDB site
Description: Crystal structure of citrate lyase beta subunit
Deposited on 2004-02-23, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.227
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sgja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgjA (A:)
    mnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaar
    dliaaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqersl
    plpilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqval
    aarltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfgpteadr
    araralldaaaaaaqrghgafsfegqmvdepmlakartllshea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgjA (A:)
    ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
    aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
    ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
    ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg