PDB entry 1sfx

View 1sfx on RCSB PDB site
Description: X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: structural genomics, conserved hypothetical protein, HTH motif, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-02-20, released 2004-08-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.15
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical protein AF2008
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF2008
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28271 (1-106)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (34)
      • modified residue (103)
      • cloning artifact (107-108)
    Domains in SCOPe 2.05: d1sfxa_
  • Chain 'B':
    Compound: Conserved hypothetical protein AF2008
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF2008
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28271
      • modified residue (34)
      • modified residue (103)
    Domains in SCOPe 2.05: d1sfxb_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfxA (A:)
    hmsnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllk
    rgfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftdgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfxB (B:)
    hmsnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllk
    rgfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfxB (B:)
    snplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkrg
    fvrreivekgwvgyiysaekpekvlkefkssilgeieriekmft