PDB entry 1sfh

View 1sfh on RCSB PDB site
Description: Reduced state of amicyanin mutant P94F
Class: electron transport
Keywords: blue copper protein, beta sandwich
Deposited on 2004-02-19, released 2004-07-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-27, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.124
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-End)
    • engineered (93)
  Domains in SCOP 1.73: d1sfha_
• Chain 'B':
  Compound: amicyanin
  Species: Paracoccus denitrificans
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-End)
    • engineered (93)
  Domains in SCOP 1.73: d1sfhb_
• Heterogens: CU1, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sfhA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sfhB (B:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve