PDB entry 1sfd
View 1sfd on RCSB PDB site
Description: oxidized form of amicyanin mutant P94F
Class: electron transport
Keywords: blue copper protein, beta sandwich, ELECTRON TRANSPORT
Deposited on
2004-02-19, released
2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.119
AEROSPACI score: 1.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: amicyanin
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauC, ami
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1sfda_ - Chain 'B':
Compound: amicyanin
Species: Paracoccus denitrificans [TaxId:266]
Gene: mauC, ami
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1sfdb_ - Heterogens: CU, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1sfdA (A:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1sfdB (B:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve