PDB entry 1sfc

View 1sfc on RCSB PDB site
Description: neuronal synaptic fusion complex
Deposited on 1998-08-24, released 1998-10-28
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.265
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1sfca_
  • Chain 'B':
    Domains in SCOP 1.65: d1sfcb_
  • Chain 'C':
    Domains in SCOP 1.65: d1sfcc_
  • Chain 'D':
    Domains in SCOP 1.65: d1sfcd_
  • Chain 'E':
    Domains in SCOP 1.65: d1sfce_
  • Chain 'F':
    Domains in SCOP 1.65: d1sfcf_
  • Chain 'G':
    Domains in SCOP 1.65: d1sfcg_
  • Chain 'H':
    Domains in SCOP 1.65: d1sfch_
  • Chain 'I':
    Domains in SCOP 1.65: d1sfci_
  • Chain 'J':
    Domains in SCOP 1.65: d1sfcj_
  • Chain 'K':
    Domains in SCOP 1.65: d1sfck_
  • Chain 'L':
    Domains in SCOP 1.65: d1sfcl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfcA (A:)
    msataatvppaapageggppapppnltsnrrlqqtqaqvdevvdimrvnvdkvlerdqkl
    selddradalqagasqfetsaaklkrkywwknlkmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcA (A:)
    nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
    krkywwknl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfcB (B:)
    giimdssiskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynveh
    avdyveravsdtkkavkyqskar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcB (B:)
    skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
    vsdtkkavkyqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sfcC (C:)
    maedadmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrv
    eegmnhinqdmkeaeknlkdlgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcC (C:)
    mrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnh
    inqdmkeaeknlkdlgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sfcD (D:)
    vvdereqmaisggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqid
    rimekadsnktrideanqratkmlgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcD (D:)
    ggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnkt
    rideanqratkmlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sfcE (E:)
    msataatvppaapageggppapppnltsnrrlqqtqaqvdevvdimrvnvdkvlerdqkl
    selddradalqagasqfetsaaklkrkywwknlkmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcE (E:)
    snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
    ywwknlkmm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sfcF (F:)
    giimdssiskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynveh
    avdyveravsdtkkavkyqskar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcF (F:)
    kqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
    sdtkkavkyqska
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sfcG (G:)
    maedadmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrv
    eegmnhinqdmkeaeknlkdlgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcG (G:)
    eemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhinqdm
    keaeknlkdlgk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sfcH (H:)
    vvdereqmaisggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqid
    rimekadsnktrideanqratkmlgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcH (H:)
    gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
    ideanqratkml
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sfcI (I:)
    msataatvppaapageggppapppnltsnrrlqqtqaqvdevvdimrvnvdkvlerdqkl
    selddradalqagasqfetsaaklkrkywwknlkmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcI (I:)
    ltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklk
    rkywwknlk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sfcJ (J:)
    giimdssiskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynveh
    avdyveravsdtkkavkyqskar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcJ (J:)
    siskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyve
    ravsdtkkavkyqs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sfcK (K:)
    maedadmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrv
    eegmnhinqdmkeaeknlkdlgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcK (K:)
    leemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhinqd
    mkeaeknlkdlgk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1sfcL (L:)
    vvdereqmaisggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqid
    rimekadsnktrideanqratkmlgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfcL (L:)
    gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
    ideanqratkmlg