PDB entry 1sf0

View 1sf0 on RCSB PDB site
Description: backbone solution structure of mixed alpha/beta protein pf1061
Deposited on 2004-02-19, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1sf0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sf0A (A:)
ahhhhhhgskmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvledd
evkdgdfvevipvvsgg

    Sequence, based on observed residues (ATOM records): (download) 
    >1sf0A (A:)
kmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfve
vipvvsgg