PDB entry 1sev

View 1sev on RCSB PDB site
Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-02-18, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase, glyoxysomal precursor
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1seva1, d1seva2
  • Chain 'B':
    Compound: Malate dehydrogenase, glyoxysomal precursor
    Species: Citrullus lanatus [TaxId:3654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sevb1, d1sevb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sevA (A:)
    mqpipdvnqriarisahlhppksqmeessalrrancrakggapgfkvailgaaggigqpl
    amlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgqqqleaaltgmdliivpa
    gvprkpgmtrddlfkinagivktlcegiakccpraivnlisnpvnstvpiaaevfkkagt
    ydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftq
    eeisyltdriqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvss
    qvtelpffaskvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sevA (A:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sevB (B:)
    mqpipdvnqriarisahlhppksqmeessalrrancrakggapgfkvailgaaggigqpl
    amlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgqqqleaaltgmdliivpa
    gvprkpgmtrddlfkinagivktlcegiakccpraivnlisnpvnstvpiaaevfkkagt
    ydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftq
    eeisyltdriqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvss
    qvtelpffaskvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sevB (B:)
    gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
    qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
    vnstvpiaaevfkkagtydpkrllgvtmldvvrantfvaevlgldprdvdvpvvgghagv
    tilpllsqvkppssftqeeisyltdriqnggtevveakagagsatlsmayaavkfadacl
    rglrgdagviecafvssqvtelpffaskvrlgrngieevyslgplneyeriglekakkel
    agsiekgvsfirs