PDB entry 1seh

View 1seh on RCSB PDB site
Description: Crystal structure of E. coli dUTPase complexed with the product dUMP
Class: hydrolase
Keywords: enzyme-ligand complex, jelly roll
Deposited on 2004-02-17, released 2004-09-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.159
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.75: d1seha_
  • Heterogens: UMP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sehA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sehA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatr