PDB entry 1se4

View 1se4 on RCSB PDB site
Description: staphylococcal enterotoxin b complexed with lactose
Deposited on 1997-04-16, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1se4_ (-)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk