PDB entry 1se3

View 1se3 on RCSB PDB site
Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide
Deposited on 1996-10-11, released 1997-06-16
The last revision prior to the SCOP 1.69 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1se3_ (-)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk